Lineage for d1xxij2 (1xxi J:1-207)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127737Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2127816Protein delta prime subunit of DNA polymerase III, N-domain [52711] (1 species)
    contains additional alpha-helical domain after the family specific domains
  7. 2127817Species Escherichia coli [TaxId:562] [52712] (6 PDB entries)
    Uniprot P28631
  8. 2127829Domain d1xxij2: 1xxi J:1-207 [116202]
    Other proteins in same PDB: d1xxia1, d1xxia2, d1xxib1, d1xxib2, d1xxic1, d1xxic2, d1xxid1, d1xxid2, d1xxie1, d1xxif1, d1xxif2, d1xxig1, d1xxig2, d1xxih1, d1xxih2, d1xxii1, d1xxii2, d1xxij1
    protein/DNA complex; complexed with adp, po4, zn

Details for d1xxij2

PDB Entry: 1xxi (more details), 4.1 Å

PDB Description: ADP Bound E. coli Clamp Loader Complex
PDB Compounds: (J:) DNA polymerase III, delta prime subunit

SCOPe Domain Sequences for d1xxij2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xxij2 c.37.1.20 (J:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}
mrwypwlrpdfeklvasyqagrghhalliqalpgmgddaliyalsryllcqqpqghkscg
hcrgcqlmqagthpdyytlapekgkntlgvdavrevteklneharlggakvvwvtdaall
tdaaanallktleeppaetwfflatreperllatlrsrcrlhylapppeqyavtwlsrev
tmsqdallaalrlsagspgaalalfqg

SCOPe Domain Coordinates for d1xxij2:

Click to download the PDB-style file with coordinates for d1xxij2.
(The format of our PDB-style files is described here.)

Timeline for d1xxij2: