Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein) |
Protein Putative glucosidase YicI, domain 3 [117299] (1 species) |
Species Escherichia coli [TaxId:562] [117300] (5 PDB entries) Uniprot P31434 |
Domain d1xske3: 1xsk E:586-665 [115993] Other proteins in same PDB: d1xska1, d1xska2, d1xska4, d1xskb1, d1xskb2, d1xskb4, d1xskc1, d1xskc2, d1xskc4, d1xskd1, d1xskd2, d1xskd4, d1xske1, d1xske2, d1xske4, d1xskf1, d1xskf2, d1xskf4 complexed with mpo, so4, xyf |
PDB Entry: 1xsk (more details), 2.2 Å
SCOPe Domain Sequences for d1xske3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xske3 b.71.1.4 (E:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]} pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld gsrwhkqqhgflslpvyvrd
Timeline for d1xske3: