Class b: All beta proteins [48724] (174 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.11: YicI N-terminal domain-like [117139] (2 proteins) |
Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species) |
Species Escherichia coli [TaxId:562] [117141] (5 PDB entries) Uniprot P31434 |
Domain d1xskd2: 1xsk D:1-247 [115988] Other proteins in same PDB: d1xska1, d1xska3, d1xska4, d1xskb1, d1xskb3, d1xskb4, d1xskc1, d1xskc3, d1xskc4, d1xskd1, d1xskd3, d1xskd4, d1xske1, d1xske3, d1xske4, d1xskf1, d1xskf3, d1xskf4 complexed with mpo, so4, xyf |
PDB Entry: 1xsk (more details), 2.2 Å
SCOPe Domain Sequences for d1xskd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xskd2 b.30.5.11 (D:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]} mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf vidgptp
Timeline for d1xskd2: