SCOPe 2.01: Domain d1xskd1: 1xsk D:666-773

Lineage for d1xskd1 (1xsk D:666-773)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family)

5. Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)

6. Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)

7. Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
   Uniprot P31434

8. Domain d1xskd1: 1xsk D:666-773 [115987]
   Other proteins in same PDB: d1xska2, d1xska3, d1xska4, d1xskb2, d1xskb3, d1xskb4, d1xskc2, d1xskc3, d1xskc4, d1xskd2, d1xskd3, d1xskd4, d1xske2, d1xske3, d1xske4, d1xskf2, d1xskf3, d1xskf4
   complexed with mpo, so4, xyf

Details for d1xskd1

PDB Entry: 1xsk, 2.2 Å

PDB Description: structure of a family 31 alpha glycosidase glycosyl-enzyme intermediate

PDB Compounds: (D:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xskd1:

Sequence; same for both SEQRES and ATOM records:

>d1xskd1 b.150.1.1 (D:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh

Timeline for d1xskd1:

• d1xskd1 first appeared in SCOP 1.71
  
• d1xskd1 appears in SCOP 1.75
  
• d1xskd1 appears in SCOPe 2.02
  
• d1xskd1 appears in the current release, SCOPe 2.08