SCOP 1.71: Domain d1xnrt_: 1xnr T:

Lineage for d1xnrt_ (1xnr T:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.7: Spectrin repeat-like [46965] (13 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family)

5. Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
   this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain

6. Protein Ribosomal protein S20 [46994] (1 species)

7. Species Thermus thermophilus [TaxId:274] [46995] (18 PDB entries)

8. Domain d1xnrt_: 1xnr T: [115645]
   Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrv_
   complexed with mg, par, zn

Details for d1xnrt_

PDB Entry: 1xnr, 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

SCOP Domain Sequences for d1xnrt_:

Sequence; same for both SEQRES and ATOM records:

>d1xnrt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

Timeline for d1xnrt_:

• d1xnrt_ is new in SCOP 1.71
  
• d1xnrt_ appears in SCOP 1.73
  
• d1xnrt_ appears in the current release, SCOPe 2.08