Lineage for d1xnrf_ (1xnr F:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604394Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 604395Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 604396Protein Ribosomal protein S6 [54997] (2 species)
  7. 604399Species Thermus thermophilus [TaxId:274] [54998] (24 PDB entries)
  8. 604408Domain d1xnrf_: 1xnr F: [115631]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnrf_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

SCOP Domain Sequences for d1xnrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnrf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1xnrf_:

Click to download the PDB-style file with coordinates for d1xnrf_.
(The format of our PDB-style files is described here.)

Timeline for d1xnrf_: