SCOP 1.71: Domain d1xnrl_: 1xnr L:

Lineage for d1xnrl_ (1xnr L:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S12 [50302] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50303] (18 PDB entries)

8. Domain d1xnrl_: 1xnr L: [115637]
   Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
   complexed with mg, par, zn

Details for d1xnrl_

PDB Entry: 1xnr, 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

SCOP Domain Sequences for d1xnrl_:

Sequence; same for both SEQRES and ATOM records:

>d1xnrl_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

Timeline for d1xnrl_:

• d1xnrl_ is new in SCOP 1.71
  
• d1xnrl_ appears in SCOP 1.73
  
• d1xnrl_ appears in the current release, SCOPe 2.08