Lineage for d1xnrp_ (1xnr P:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601312Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 601313Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 601314Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 601315Protein Ribosomal protein S16 [54567] (1 species)
  7. 601316Species Thermus thermophilus [TaxId:274] [54568] (19 PDB entries)
  8. 601323Domain d1xnrp_: 1xnr P: [115641]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnrp_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

SCOP Domain Sequences for d1xnrp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnrp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1xnrp_:

Click to download the PDB-style file with coordinates for d1xnrp_.
(The format of our PDB-style files is described here.)

Timeline for d1xnrp_: