Lineage for d1we7a1 (1we7 A:8-109)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931466Protein Splicing factor 3 subunit 1, C-terminal domain [117799] (3 species)
  7. 2931469Species Mouse (Mus musculus) [TaxId:10090] [117800] (1 PDB entry)
    Uniprot Q8K4Z5 685-786
  8. 2931470Domain d1we7a1: 1we7 A:8-109 [114547]
    Other proteins in same PDB: d1we7a2, d1we7a3
    Structural genomics target

Details for d1we7a1

PDB Entry: 1we7 (more details)

PDB Description: solution structure of ubiquitin-like domain in sf3a120
PDB Compounds: (A:) Sf3a1 protein

SCOPe Domain Sequences for d1we7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1we7a1 d.15.1.1 (A:8-109) Splicing factor 3 subunit 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
tedslmpeeeflrrnkgpvsikvqvpnmqdktewklngqglvftlpltdqvsvikvkihe
atgmpagkqklqyegifikdsnslayynmasgavihlalker

SCOPe Domain Coordinates for d1we7a1:

Click to download the PDB-style file with coordinates for d1we7a1.
(The format of our PDB-style files is described here.)

Timeline for d1we7a1: