Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins) probably stems out from the biMOP domain |
Protein Hypothetical protein PH0022, C-terminal domain [117208] (1 species) |
Species Pyrococcus horikoshii [TaxId:53953] [117209] (2 PDB entries) Uniprot O57758 |
Domain d1v43a1: 1v43 A:246-299 [113521] Other proteins in same PDB: d1v43a3 fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1v43 (more details), 2.2 Å
SCOPe Domain Sequences for d1v43a1:
Sequence, based on SEQRES records: (download)
>d1v43a1 b.40.6.3 (A:246-299) Hypothetical protein PH0022, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} pemnilevsvgdgylegrgfrielpqdlmdllkdyvgktvlfgirpehmtvegv
>d1v43a1 b.40.6.3 (A:246-299) Hypothetical protein PH0022, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} pemnilevsvgdgylegrgfrielpqmdllkdyvgktvlfgirpehmtvegv
Timeline for d1v43a1: