SCOPe 2.08: Domain d1ss2a1: 1ss2 A:96-159

Lineage for d1ss2a1 (1ss2 A:96-159)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein GABA-B receptor 1 [118257] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [118258] (2 PDB entries)
   Uniprot Q9Z0U4 96-159

8. Domain d1ss2a1: 1ss2 A:96-159 [112111]
   Other proteins in same PDB: d1ss2a2

Details for d1ss2a1

PDB Entry: 1ss2

PDB Description: solution structure of the second complement control protein (ccp) module of the gaba(b)r1a receptor, pro-119 cis conformer

PDB Compounds: (A:) Gamma-aminobutyric acid type B receptor, subunit 1

SCOPe Domain Sequences for d1ss2a1:

Sequence; same for both SEQRES and ATOM records:

>d1ss2a1 g.18.1.1 (A:96-159) GABA-B receptor 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vricsksyltlengkvfltggdlpaldgarvefrcdpdfhlvgssrsvcsqgqwstpkph
cqvn

Timeline for d1ss2a1:

• d1ss2a1 first appeared in SCOP 1.71, called d1ss2a_
  
• d1ss2a1 appears in SCOPe 2.07