Lineage for d1ss2a_ (1ss2 A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 623526Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 623527Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 623528Family g.18.1.1: Complement control module/SCR domain [57536] (11 proteins)
    Pfam 00084
  6. 623709Protein GABA-B receptor 1 [118257] (1 species)
  7. 623710Species Rat (Rattus norvegicus) [TaxId:10116] [118258] (2 PDB entries)
  8. 623711Domain d1ss2a_: 1ss2 A: [112111]

Details for d1ss2a_

PDB Entry: 1ss2 (more details)

PDB Description: solution structure of the second complement control protein (ccp) module of the gaba(b)r1a receptor, pro-119 cis conformer

SCOP Domain Sequences for d1ss2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ss2a_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus)}
eaefvricsksyltlengkvfltggdlpaldgarvefrcdpdfhlvgssrsvcsqgqwst
pkphcqvn

SCOP Domain Coordinates for d1ss2a_:

Click to download the PDB-style file with coordinates for d1ss2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ss2a_: