| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.8: Ppx/GppA phosphatase [110630] (2 proteins) Pfam PF02541 |
| Protein Exopolyphosphatase Ppx [110631] (2 species) |
| Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries) Uniprot O67040 |
| Domain d1t6db1: 1t6d B:8-132 [106562] complexed with cl, trs |
PDB Entry: 1t6d (more details), 2.15 Å
SCOPe Domain Sequences for d1t6db1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6db1 c.55.1.8 (B:8-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]}
imrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqvl
keykklidefkvermkavateairraknaeeflervkrevglvvevitpeqegryaylav
ayslk
Timeline for d1t6db1: