Lineage for d1t6db1 (1t6d B:8-132)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488363Family c.55.1.8: Ppx/GppA phosphatase (Pfam 02541) [110630] (1 protein)
  6. 488364Protein Exopolyphosphatase Ppx [110631] (1 species)
  7. 488365Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries)
  8. 488370Domain d1t6db1: 1t6d B:8-132 [106562]

Details for d1t6db1

PDB Entry: 1t6d (more details), 2.15 Å

PDB Description: miras phasing of the aquifex aeolicus ppx/gppa phosphatase: crystal structure of the type ii variant

SCOP Domain Sequences for d1t6db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t6db1 c.55.1.8 (B:8-132) Exopolyphosphatase Ppx {Aquifex aeolicus}
imrvasidigsysvrltiaqikdgklsiilergritslgtkvketgrlqedrieetiqvl
keykklidefkvermkavateairraknaeeflervkrevglvvevitpeqegryaylav
ayslk

SCOP Domain Coordinates for d1t6db1:

Click to download the PDB-style file with coordinates for d1t6db1.
(The format of our PDB-style files is described here.)

Timeline for d1t6db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t6db2