Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.8: Ppx/GppA phosphatase [110630] (2 proteins) Pfam PF02541 |
Protein Exopolyphosphatase Ppx [110631] (2 species) |
Species Aquifex aeolicus [TaxId:63363] [110632] (2 PDB entries) Uniprot O67040 |
Domain d1t6db2: 1t6d B:133-307 [106563] complexed with cl, trs |
PDB Entry: 1t6d (more details), 2.15 Å
SCOPe Domain Sequences for d1t6db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t6db2 c.55.1.8 (B:133-307) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} pegevmvvdqgggsteyvfgkgykvrevislpigivnltetffkqdppteeevkrffefl ekelskvkkpvdtivglggtittlaaleynvypydpqkvhgkvltygqikkwfdtfkeip seerskrfrqvedrrakvilagigiflktleifekdclivsdwglregvlvseml
Timeline for d1t6db2: