Lineage for d1sl0d_ (1sl0 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852482Protein Thioredoxin [52835] (15 species)
  7. 1852498Species Escherichia coli [TaxId:562] [52836] (48 PDB entries)
    Uniprot P00274 ! Uniprot P00581
  8. 1852578Domain d1sl0d_: 1sl0 D: [105702]
    Other proteins in same PDB: d1sl0a1, d1sl0a2, d1sl0c1, d1sl0c2
    protein/DNA complex; complexed with dad, mg

Details for d1sl0d_

PDB Entry: 1sl0 (more details), 3.2 Å

PDB Description: Ternary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template and an incoming nucleotide
PDB Compounds: (D:) Thioredoxin 1

SCOPe Domain Sequences for d1sl0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sl0d_ c.47.1.1 (D:) Thioredoxin {Escherichia coli [TaxId: 562]}
kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl

SCOPe Domain Coordinates for d1sl0d_:

Click to download the PDB-style file with coordinates for d1sl0d_.
(The format of our PDB-style files is described here.)

Timeline for d1sl0d_: