Lineage for d1sl0c1 (1sl0 C:1-210)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859666Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1859938Protein Exonuclease domain of T7 DNA polymerase [53123] (1 species)
  7. 1859939Species Bacteriophage T7 [TaxId:10760] [53124] (17 PDB entries)
    Uniprot P00581
  8. 1859958Domain d1sl0c1: 1sl0 C:1-210 [105700]
    Other proteins in same PDB: d1sl0a2, d1sl0b_, d1sl0c2, d1sl0d_
    protein/DNA complex; complexed with dad, mg

Details for d1sl0c1

PDB Entry: 1sl0 (more details), 3.2 Å

PDB Description: Ternary 3' complex of T7 DNA polymerase with a DNA primer/template containing a disordered cis-syn thymine dimer on the template and an incoming nucleotide
PDB Compounds: (C:) DNA polymerase

SCOPe Domain Sequences for d1sl0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sl0c1 c.55.3.5 (C:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]}
mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
sdkhyfppeidftdvgyttfwses

SCOPe Domain Coordinates for d1sl0c1:

Click to download the PDB-style file with coordinates for d1sl0c1.
(The format of our PDB-style files is described here.)

Timeline for d1sl0c1: