SCOPe 2.02: Domain d1sgmb2: 1sgm B:78-188

Lineage for d1sgmb2 (1sgm B:78-188)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)

6. Protein Putative transcriptional regulator YxaF [109984] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [109985] (1 PDB entry)
   Uniprot P42105

8. Domain d1sgmb2: 1sgm B:78-188 [105540]
   Other proteins in same PDB: d1sgma1, d1sgmb1

Details for d1sgmb2

PDB Entry: 1sgm, 2 Å

PDB Description: crystal structure of hypothetical protein yxaf

PDB Compounds: (B:) Putative HTH-type transcriptional regulator yxaF

SCOPe Domain Sequences for d1sgmb2:

Sequence; same for both SEQRES and ATOM records:

>d1sgmb2 a.121.1.1 (B:78-188) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]}
sdpveaiqlfikktasqfdntesikgipvgllasetaliseplrtvcmkvfksweavfar
klmengfaeeeanqlgtlinsmieggimlsltnkdktpllliaeqipvlvr

Timeline for d1sgmb2:

• d1sgmb2 first appeared in SCOP 1.69
  
• d1sgmb2 appears in SCOPe 2.01
  
• d1sgmb2 appears in SCOPe 2.03
  
• d1sgmb2 appears in the current release, SCOPe 2.08