SCOPe 2.02: Domain d1sgma1: 1sgm A:5-77

Lineage for d1sgma1 (1sgm A:5-77)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Putative transcriptional regulator YxaF [109657] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [109658] (1 PDB entry)
   Uniprot P42105

8. Domain d1sgma1: 1sgm A:5-77 [105537]
   Other proteins in same PDB: d1sgma2, d1sgmb2

Details for d1sgma1

PDB Entry: 1sgm, 2 Å

PDB Description: crystal structure of hypothetical protein yxaf

PDB Compounds: (A:) Putative HTH-type transcriptional regulator yxaF

SCOPe Domain Sequences for d1sgma1:

Sequence; same for both SEQRES and ATOM records:

>d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]}
gdsrekilhtasrlsqlqgyhatglnqivkesgapkgslyhffpngkeelaieavtytgk
ivehliqqsmdes

Timeline for d1sgma1:

• d1sgma1 first appeared in SCOP 1.69
  
• d1sgma1 appears in SCOPe 2.01
  
• d1sgma1 appears in SCOPe 2.03
  
• d1sgma1 appears in the current release, SCOPe 2.08