Lineage for d1sgmb2 (1sgm B:78-188)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447981Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 447982Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 447983Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)
  6. 448053Protein Putative transcriptional regulator YxaF [109984] (1 species)
  7. 448054Species Bacillus subtilis [TaxId:1423] [109985] (1 PDB entry)
  8. 448056Domain d1sgmb2: 1sgm B:78-188 [105540]
    Other proteins in same PDB: d1sgma1, d1sgmb1

Details for d1sgmb2

PDB Entry: 1sgm (more details), 2 Å

PDB Description: crystal structure of hypothetical protein yxaf

SCOP Domain Sequences for d1sgmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgmb2 a.121.1.1 (B:78-188) Putative transcriptional regulator YxaF {Bacillus subtilis}
sdpveaiqlfikktasqfdntesikgipvgllasetaliseplrtvcmkvfksweavfar
klmengfaeeeanqlgtlinsmieggimlsltnkdktpllliaeqipvlvr

SCOP Domain Coordinates for d1sgmb2:

Click to download the PDB-style file with coordinates for d1sgmb2.
(The format of our PDB-style files is described here.)

Timeline for d1sgmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sgmb1