SCOP 1.67: Domain d1uwel2: 1uwe L:108-212

Lineage for d1uwel2 (1uwe L:108-212)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (74 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1uwel2: 1uwe L:108-212 [100106]
   Other proteins in same PDB: d1uweh1, d1uweh2, d1uwel1, d1uweu1, d1uwev1, d1uwev2, d1uwex1, d1uwey1, d1uwey2

Details for d1uwel2

PDB Entry: 1uwe, 2.67 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

SCOP Domain Sequences for d1uwel2:

Sequence; same for both SEQRES and ATOM records:

>d1uwel2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsaeqlasgtasvvcllnnfypreaavqwkvdnalqsgnsqesvteqd
sadstyslsstltlskadyeahavyacevthqglsspvtksfnrg

Timeline for d1uwel2:

• d1uwel2 is new in SCOP 1.67
  
• d1uwel2 appears in SCOP 1.69
  
• d1uwel2 appears in the current release, SCOPe 2.08