Lineage for d1uweu2 (1uwe U:108-212)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365640Species Human (Homo sapiens) [TaxId:9606] [88569] (74 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 365724Domain d1uweu2: 1uwe U:108-212 [100108]
    Other proteins in same PDB: d1uweh1, d1uweh2, d1uwel1, d1uweu1, d1uwev1, d1uwev2, d1uwex1, d1uwey1, d1uwey2

Details for d1uweu2

PDB Entry: 1uwe (more details), 2.67 Å

PDB Description: molecular mechanism of enantioselective proton transfer to carbon in catalytic antibody 14d9

SCOP Domain Sequences for d1uweu2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uweu2 b.1.1.2 (U:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsaeqlasgtasvvcllnnfypreaavqwkvdnalqsgnsqesvteqd
sadstyslsstltlskadyeahavyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1uweu2:

Click to download the PDB-style file with coordinates for d1uweu2.
(The format of our PDB-style files is described here.)

Timeline for d1uweu2: