Class a: All alpha proteins [46456] (290 folds) |
Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily) multihelical; array |
Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains automatically mapped to Pfam PF09150 |
Family a.175.1.0: automated matches [326230] (1 protein) not a true family |
Protein automated matches [326231] (3 species) not a true protein |
Species Tolypothrix sp. [TaxId:1188] [385920] (1 PDB entry) |
Domain d6pq1a1: 6pq1 A:2-175 [385921] Other proteins in same PDB: d6pq1a2, d6pq1a3 automated match to d5ui2a1 complexed with 45d |
PDB Entry: 6pq1 (more details), 1.61 Å
SCOPe Domain Sequences for d6pq1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pq1a1 a.175.1.0 (A:2-175) automated matches {Tolypothrix sp. [TaxId: 1188]} pftidsargifpetltadsvpatiarfnqlsaedqlaliwfaylemgktitiaapgaanm vfaentlnelkqmsfqeqtqvmcdlanradtpicrtyaiwsvniklgfwyrlaewmeqgi vapipqgyrlsanaaavlqaireldagqqitvlrnsvvdmgydpsklgsytkvs
Timeline for d6pq1a1: