Lineage for d6pq1a1 (6pq1 A:2-175)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348932Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2348933Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2348966Family a.175.1.0: automated matches [326230] (1 protein)
    not a true family
  6. 2348967Protein automated matches [326231] (2 species)
    not a true protein
  7. 2348971Species Tolypothrix sp. [TaxId:1188] [385920] (1 PDB entry)
  8. 2348972Domain d6pq1a1: 6pq1 A:2-175 [385921]
    Other proteins in same PDB: d6pq1a2, d6pq1a3
    automated match to d5ui2a1
    complexed with 45d

Details for d6pq1a1

PDB Entry: 6pq1 (more details), 1.61 Å

PDB Description: structure of the fremyella diplosiphon ocp1
PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d6pq1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pq1a1 a.175.1.0 (A:2-175) automated matches {Tolypothrix sp. [TaxId: 1188]}
pftidsargifpetltadsvpatiarfnqlsaedqlaliwfaylemgktitiaapgaanm
vfaentlnelkqmsfqeqtqvmcdlanradtpicrtyaiwsvniklgfwyrlaewmeqgi
vapipqgyrlsanaaavlqaireldagqqitvlrnsvvdmgydpsklgsytkvs

SCOPe Domain Coordinates for d6pq1a1:

Click to download the PDB-style file with coordinates for d6pq1a1.
(The format of our PDB-style files is described here.)

Timeline for d6pq1a1: