Lineage for d6ghgl_ (6ghg L:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755504Domain d6ghgl_: 6ghg L: [416015]
    Other proteins in same PDB: d6ghga_, d6ghgh_
    automated match to d6shgl_
    complexed with na, p6g

Details for d6ghgl_

PDB Entry: 6ghg (more details), 1.88 Å

PDB Description: variable heavy - variable light domain and fab-arm crossmabs with charged residue exchanges
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d6ghgl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ghgl_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspltfgqgtkveikrtvaapsvfifp
psdkklksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
tlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d6ghgl_:

Click to download the PDB-style file with coordinates for d6ghgl_.
(The format of our PDB-style files is described here.)

Timeline for d6ghgl_:

  • d6ghgl_ is new in SCOPe 2.08-stable