Lineage for d5eb9a_ (5eb9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 2754096Domain d5eb9a_: 5eb9 A: [322542]
    automated match to d2arjr_

Details for d5eb9a_

PDB Entry: 5eb9 (more details), 2.01 Å

PDB Description: crystal structure of chicken cd8aa homodimer
PDB Compounds: (A:) CD8 alpha chain

SCOPe Domain Sequences for d5eb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eb9a_ b.1.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tmearflnrnmkhpqegqplelecmpfnidngvswirqdkdgklhfivyisplsrtafpr
nertssqfegskqgssfrlvvknfraqdqgtyfcianinqmlyfssgqpaff

SCOPe Domain Coordinates for d5eb9a_:

Click to download the PDB-style file with coordinates for d5eb9a_.
(The format of our PDB-style files is described here.)

Timeline for d5eb9a_: