Lineage for d4z9vb_ (4z9v B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2626683Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2626689Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 2626690Species Human (Homo sapiens) [TaxId:9606] [56857] (46 PDB entries)
  8. 2626747Domain d4z9vb_: 4z9v B: [312403]
    Other proteins in same PDB: d4z9va2
    automated match to d1zy3a1
    complexed with bct, na

Details for d4z9vb_

PDB Entry: 4z9v (more details), 2.1 Å

PDB Description: tctp contains a bh3-like domain, which instead of inhibiting, activates bcl-xl
PDB Compounds: (B:) Bcl-2-like protein 1,APOPTOSIS REGULATOR BCL-XL

SCOPe Domain Sequences for d4z9vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z9vb_ f.1.4.1 (B:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaaaesrkgq

SCOPe Domain Coordinates for d4z9vb_:

Click to download the PDB-style file with coordinates for d4z9vb_.
(The format of our PDB-style files is described here.)

Timeline for d4z9vb_: