SCOPe 2.08: Domain d4z9vb_: 4z9v B:

Lineage for d4z9vb_ (4z9v B:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)

8. Domain d4z9vb_: 4z9v B: [312403]
   Other proteins in same PDB: d4z9va2
   automated match to d1zy3a1
   complexed with bct, na

Details for d4z9vb_

PDB Entry: 4z9v, 2.1 Å

PDB Description: tctp contains a bh3-like domain, which instead of inhibiting, activates bcl-xl

PDB Compounds: (B:) Bcl-2-like protein 1,APOPTOSIS REGULATOR BCL-XL

SCOPe Domain Sequences for d4z9vb_:

Sequence; same for both SEQRES and ATOM records:

>d4z9vb_ f.1.4.1 (B:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaaaesrkgq

Timeline for d4z9vb_:

• d4z9vb_ first appeared in SCOPe 2.06
  
• d4z9vb_ appears in SCOPe 2.07