Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein Apoptosis regulator Bcl-xL [56856] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56857] (46 PDB entries) |
Domain d4z9va1: 4z9v A:1-208 [312299] Other proteins in same PDB: d4z9va2 automated match to d1zy3a1 complexed with bct, na |
PDB Entry: 4z9v (more details), 2.1 Å
SCOPe Domain Sequences for d4z9va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z9va1 f.1.4.1 (A:1-208) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]} msqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitp gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd hlepwiqenggwdtfvelygnnaaaesrkgqe
Timeline for d4z9va1: