Lineage for d4ocrl1 (4ocr L:2-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754867Domain d4ocrl1: 4ocr L:2-106 [267026]
    Other proteins in same PDB: d4ocrl2
    automated match to d8faba1

Details for d4ocrl1

PDB Entry: 4ocr (more details), 1.9 Å

PDB Description: Crystal structure of human Fab CAP256-VRC26.01, a potent V1V2-directed HIV-1 neutralizing antibody
PDB Compounds: (L:) CAP256-VRC26.01 light chain

SCOPe Domain Sequences for d4ocrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ocrl1 b.1.1.0 (L:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsaapgqkvtiscsgssstignnyvswyrllpgtapklliykndnrpsgipd
rfsgsksgtsatlgisglqtgdeadyycgtwdtslsgggvfgtgtkvtv

SCOPe Domain Coordinates for d4ocrl1:

Click to download the PDB-style file with coordinates for d4ocrl1.
(The format of our PDB-style files is described here.)

Timeline for d4ocrl1:

2754867
d4ocrl1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4ocrl2