Lineage for d4dxga2 (4dxg A:100-200)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.0: automated matches [227139] (1 protein)
not a true familyProtein automated matches [226841] (5 species)
not a true protein
Species Staphylococcus aureus [TaxId:426430] [267924] (2 PDB entries) 
Domain d4dxga2: 4dxg A:100-200 [266165]
Other proteins in same PDB: d4dxga1
automated match to d4rcob2
complexed with cl, pin
Details for d4dxga2
PDB Entry: 4dxg (more details), 2.5 Å
PDB Description: crystal structure of staphylococcal superantigen-like protein 4 complexed with sialyl lewis x
PDB Compounds: (A:) Staphylococcal enterotoxin-like toxinSCOPe Domain Sequences for d4dxga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dxga2 d.15.6.0 (A:100-200) automated matches {Staphylococcus aureus [TaxId: 426430]}
kvdhkagvritkednkgtishdvsefkitkeqislkeldfklrkqlieknnlygnvgsgk
ivikmknggkytfelhkklqenrmadvidgtnidnievnik
SCOPe Domain Coordinates for d4dxga2:
Click to download the PDB-style file with coordinates for d4dxga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4dxga2:
- d4dxga2 first appeared in SCOPe 2.05
- d4dxga2 appears in SCOPe 2.07
- d4dxga2 appears in the current release, SCOPe 2.08
View in 3D
