SCOPe 2.06: Domain d4dxga1: 4dxg A:7-99

Lineage for d4dxga1 (4dxg A:7-99)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:426430] [267923] (1 PDB entry)

8. Domain d4dxga1: 4dxg A:7-99 [266164]
   Other proteins in same PDB: d4dxga2
   automated match to d4rcob1
   complexed with cl, pin

Details for d4dxga1

PDB Entry: 4dxg, 2.5 Å

PDB Description: crystal structure of staphylococcal superantigen-like protein 4 complexed with sialyl lewis x

PDB Compounds: (A:) Staphylococcal enterotoxin-like toxin

SCOPe Domain Sequences for d4dxga1:

Sequence; same for both SEQRES and ATOM records:

>d4dxga1 b.40.2.0 (A:7-99) automated matches {Staphylococcus aureus [TaxId: 426430]}
einpkfkdlrayytkpslefkneigiilkkwttirfmnvvpdyfiykialvgkddkkyge
gvhrnvdvfvvleennynlekysvggitksnsk

Timeline for d4dxga1:

• d4dxga1 first appeared in SCOPe 2.05
  
• d4dxga1 appears in SCOPe 2.07
  
• d4dxga1 appears in the current release, SCOPe 2.08