Lineage for d4rcob2 (4rco B:208-308)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179689Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2179910Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2179911Protein automated matches [226841] (5 species)
    not a true protein
  7. 2179939Species Staphylococcus aureus [TaxId:93061] [226096] (6 PDB entries)
  8. 2179945Domain d4rcob2: 4rco B:208-308 [260018]
    Other proteins in same PDB: d4rcoa1, d4rcob1
    automated match to d2rdga2
    complexed with cl

Details for d4rcob2

PDB Entry: 4rco (more details), 1.9 Å

PDB Description: 1.9 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d4rcob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rcob2 d.15.6.0 (B:208-308) automated matches {Staphylococcus aureus [TaxId: 93061]}
kvdhkagvritkednkgtishdvsefkitkeqislkeldfklrkqlieknnlygnvgsgk
ivikmknggkytfelhkklqenrmadvidgtnidnievnik

SCOPe Domain Coordinates for d4rcob2:

Click to download the PDB-style file with coordinates for d4rcob2.
(The format of our PDB-style files is described here.)

Timeline for d4rcob2:

2179945
d4rcob2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4rcob1