Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
Protein automated matches [190537] (10 species) not a true protein |
Species Pleurotus cornucopiae [TaxId:5321] [188786] (1 PDB entry) |
Domain d2zsca_: 2zsc A: [171461] automated match to d1hy2a_ complexed with btn, gol, mg |
PDB Entry: 2zsc (more details), 1.3 Å
SCOPe Domain Sequences for d2zsca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zsca_ b.61.1.0 (A:) automated matches {Pleurotus cornucopiae [TaxId: 5321]} sdvqssltgtwynelnskmeltankdgtltgkylskvgdvyvpyplsgrynlqppagqgv algwavswenskihsattwsgqffsesspviltqwllssstargdvwestlvgndsftkt apt
Timeline for d2zsca_: