Lineage for d2wo5a_ (2wo5 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1147696Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1148206Protein automated matches [190095] (15 species)
    not a true protein
  7. 1148215Species Escherichia coli [TaxId:469008] [189446] (3 PDB entries)
  8. 1148221Domain d2wo5a_: 2wo5 A: [169505]
    automated match to d1hl2a_

Details for d2wo5a_

PDB Entry: 2wo5 (more details), 2.2 Å

PDB Description: structure of wild type e. coli n-acetylneuraminic acid lyase in space group p21 crystal form i
PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d2wo5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wo5a_ c.1.10.1 (A:) automated matches {Escherichia coli [TaxId: 469008]}
hhhatnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslse
reqvleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeeh
cdhyraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqir
rehpdlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqte
cnkvidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqerg

SCOPe Domain Coordinates for d2wo5a_:

Click to download the PDB-style file with coordinates for d2wo5a_.
(The format of our PDB-style files is described here.)

Timeline for d2wo5a_: