Lineage for d1hl2a_ (1hl2 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1147695Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1147696Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1148131Protein N-acetylneuraminate lyase [51571] (2 species)
  7. 1148132Species Escherichia coli [TaxId:562] [51572] (4 PDB entries)
  8. 1148133Domain d1hl2a_: 1hl2 A: [83581]
    complexed with 3py; mutant

Details for d1hl2a_

PDB Entry: 1hl2 (more details), 1.8 Å

PDB Description: crystal structure of n-acetylneuraminate lyase from e. coli mutant l142r in complex with b-hydroxypyruvate
PDB Compounds: (A:) n-acetylneuraminate lyase subunit

SCOPe Domain Sequences for d1hl2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]}
tnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqv
leivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdhy
raiidsadglpmvvyniparsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirrehp
dlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkv
idlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqerg

SCOPe Domain Coordinates for d1hl2a_:

Click to download the PDB-style file with coordinates for d1hl2a_.
(The format of our PDB-style files is described here.)

Timeline for d1hl2a_: