Lineage for d2wo5a1 (2wo5 A:2-297)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835058Species Escherichia coli [TaxId:469008] [189446] (6 PDB entries)
  8. 2835070Domain d2wo5a1: 2wo5 A:2-297 [169505]
    Other proteins in same PDB: d2wo5a2
    automated match to d1hl2a_

Details for d2wo5a1

PDB Entry: 2wo5 (more details), 2.2 Å

PDB Description: structure of wild type e. coli n-acetylneuraminic acid lyase in space group p21 crystal form i
PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d2wo5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wo5a1 c.1.10.1 (A:2-297) automated matches {Escherichia coli [TaxId: 469008]}
atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq
vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh
yraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirreh
pdlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk
vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqerg

SCOPe Domain Coordinates for d2wo5a1:

Click to download the PDB-style file with coordinates for d2wo5a1.
(The format of our PDB-style files is described here.)

Timeline for d2wo5a1: