Lineage for d2o6ca_ (2o6c A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) 
Pfam PF10634
Family b.1.33.1: Membrane antigen precursor-like [310656] (2 proteins) 
Protein Tp34 lipoprotein [310819] (1 species) Species Treponema pallidum [TaxId:160] [311086] (4 PDB entries) 
Domain d2o6ca_: 2o6c A: [304254]
complexed with cl, edo, so4
Details for d2o6ca_
PDB Entry: 2o6c (more details), 1.7 Å
PDB Description: structure of selenomethionyl rtp34 from treponema pallidum
PDB Compounds: (A:) 34 kDa membrane antigenSCOPe Domain Sequences for d2o6ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o6ca_ b.1.33.1 (A:) Tp34 lipoprotein {Treponema pallidum [TaxId: 160]}
fdefpigedrdvgplhvggvyfqpvemhpapgaqpskeeadchieadihaneagkdlgyg
vgdfvpylrvvaflqkhgsekvqkvmfapmnagdgphyganvkfeeglgtykvrfeiaap
shdeyslhideqtgvsgrfwseplvaewddfewkgpqw
SCOPe Domain Coordinates for d2o6ca_:
Click to download the PDB-style file with coordinates for d2o6ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2o6ca_:
- d2o6ca_ first appeared in SCOPe 2.06
- d2o6ca_ appears in SCOPe 2.07
View in 3D
