![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
![]() | Protein automated matches [190172] (8 species) not a true protein |
![]() | Species Pyrobaculum aerophilum [TaxId:178306] [187120] (2 PDB entries) |
![]() | Domain d2gm7b_: 2gm7 B: [135365] Other proteins in same PDB: d2gm7a1 automated match to d1udda_ complexed with gol, pe4, po4 |
PDB Entry: 2gm7 (more details), 2.8 Å
SCOPe Domain Sequences for d2gm7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gm7b_ a.132.1.0 (B:) automated matches {Pyrobaculum aerophilum [TaxId: 178306]} gvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaasr apsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstca legfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlravl dssglsaeelwpyfkeaslyelefwqaayegh
Timeline for d2gm7b_: