Lineage for d2gm7c_ (2gm7 C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1505047Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1505048Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1505276Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 1505277Protein automated matches [190172] (8 species)
    not a true protein
  7. 1505291Species Pyrobaculum aerophilum [TaxId:178306] [187120] (2 PDB entries)
  8. 1505297Domain d2gm7c_: 2gm7 C: [135366]
    Other proteins in same PDB: d2gm7a1
    automated match to d1udda_
    complexed with gol, pe4, po4

Details for d2gm7c_

PDB Entry: 2gm7 (more details), 2.8 Å

PDB Description: tena homolog/thi-4 thiaminase from pyrobaculum aerophilum
PDB Compounds: (C:) tenA homolog/Thi-4 Thiaminase

SCOPe Domain Sequences for d2gm7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gm7c_ a.132.1.0 (C:) automated matches {Pyrobaculum aerophilum [TaxId: 178306]}
gvtgelrrradgiwqrilahpfvaelyagtlpmekfkyyllqdynylvnfakalslaasr
apsvdlmktalelaygtvtgemanyeallkevglslrdaaeaepnrvnvsymaylkstca
legfyqcmaallpcfwsyaeiaerhggklrenpvhvykkwasvylspeyrglverlravl
dssglsaeelwpyfkeaslyelefwqaayegh

SCOPe Domain Coordinates for d2gm7c_:

Click to download the PDB-style file with coordinates for d2gm7c_.
(The format of our PDB-style files is described here.)

Timeline for d2gm7c_: