Lineage for d2cyya2 (2cyy A:65-151)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (5 proteins)
octamer: tetramer of dimers
automatically mapped to Pfam PF01037Protein automated matches [254502] (2 species)
not a true proteinSpecies Pyrococcus horikoshii [TaxId:53953] [255099] (1 PDB entry) 
Domain d2cyya2: 2cyy A:65-151 [131029]
Other proteins in same PDB: d2cyya1
automated match to d2cyya2
complexed with ca, gln
Details for d2cyya2
PDB Entry: 2cyy (more details), 1.8 Å
PDB Description: Crystal structure of PH1519 from Pyrococcus horikosii OT3
PDB Compounds: (A:) Putative HTH-type transcriptional regulator PH1519SCOPe Domain Sequences for d2cyya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cyya2 d.58.4.2 (A:65-151) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpik
SCOPe Domain Coordinates for d2cyya2:
Click to download the PDB-style file with coordinates for d2cyya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cyya2:
- d2cyya2 first appeared in SCOP 1.73
- d2cyya2 appears in SCOPe 2.07
View in 3D
