SCOP 1.73: Domain d2cyya2: 2cyy A:65-150

Lineage for d2cyya2 (2cyy A:65-150)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.2: Lrp/AsnC-like transcriptional regulator C-terminal domain [69733] (4 proteins)
   octamer: tetramer of dimers

6. Protein Putative transcriptional regulator PH1519 [102968] (1 species)
   archaeal feast/famine regulatory protein

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [102969] (2 PDB entries)
   identical sequence to Pyrococcus sp. ot3 protein

8. Domain d2cyya2: 2cyy A:65-150 [131029]
   Other proteins in same PDB: d2cyya1
   automatically matched to d1ri7a2
   complexed with ca, gln

Details for d2cyya2

PDB Entry: 2cyy, 1.8 Å

PDB Description: Crystal structure of PH1519 from Pyrococcus horikosii OT3

PDB Compounds: (A:) Putative HTH-type transcriptional regulator PH1519

SCOP Domain Sequences for d2cyya2:

Sequence; same for both SEQRES and ATOM records:

>d2cyya2 d.58.4.2 (A:65-150) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
ysmlafilvkvkagkysevasnlakypeivevyettgdydmvvkirtknseelnnfldli
gsipgvegthtmivlkthkettelpi

Timeline for d2cyya2:

• d2cyya2 is new in SCOP 1.73
  
• d2cyya2 appears in SCOP 1.75
  
• d2cyya2 appears in the current release, SCOPe 2.08