Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
Protein Periplasmic chaperone FimC [49358] (1 species) |
Species Escherichia coli [TaxId:562] [49359] (11 PDB entries) |
Domain d1ze3c1: 1ze3 C:1-121 [124974] Other proteins in same PDB: d1ze3c2, d1ze3d1, d1ze3h_ automated match to d1bf8a1 complexed with edo |
PDB Entry: 1ze3 (more details), 1.84 Å
SCOPe Domain Sequences for d1ze3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ze3c1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl a
Timeline for d1ze3c1: