Lineage for d1ze3c1 (1ze3 C:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764596Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2764597Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 2764615Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 2764616Species Escherichia coli [TaxId:562] [49359] (11 PDB entries)
  8. 2764617Domain d1ze3c1: 1ze3 C:1-121 [124974]
    Other proteins in same PDB: d1ze3c2, d1ze3d1, d1ze3h_
    automated match to d1bf8a1
    complexed with edo

Details for d1ze3c1

PDB Entry: 1ze3 (more details), 1.84 Å

PDB Description: Crystal Structure of the Ternary Complex of FIMD (N-Terminal Domain) with FIMC and the Pilin Domain of FIMH
PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d1ze3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ze3c1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOPe Domain Coordinates for d1ze3c1:

Click to download the PDB-style file with coordinates for d1ze3c1.
(The format of our PDB-style files is described here.)

Timeline for d1ze3c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ze3c2