Lineage for d1ycsb2 (1ycs B:457-519)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782863Protein 53BP2 [50078] (1 species)
  7. 2782864Species Human (Homo sapiens) [TaxId:9606] [50079] (1 PDB entry)
  8. 2782865Domain d1ycsb2: 1ycs B:457-519 [24553]
    Other proteins in same PDB: d1ycsa_, d1ycsb1
    complexed with zn

Details for d1ycsb2

PDB Entry: 1ycs (more details), 2.2 Å

PDB Description: p53-53bp2 complex
PDB Compounds: (B:) 53bp2

SCOPe Domain Sequences for d1ycsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]}
imnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllg
lyp

SCOPe Domain Coordinates for d1ycsb2:

Click to download the PDB-style file with coordinates for d1ycsb2.
(The format of our PDB-style files is described here.)

Timeline for d1ycsb2:

2782865
d1ycsb2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ycsb1
2782865
d1ycsb2 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1ycsa_