Lineage for d1ycsb2 (1ycs B:457-519)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13069Protein 53BP2 [50078] (1 species)
  7. 13070Species Human (Homo sapiens) [TaxId:9606] [50079] (1 PDB entry)
  8. 13071Domain d1ycsb2: 1ycs B:457-519 [24553]
    Other proteins in same PDB: d1ycsa_, d1ycsb1

Details for d1ycsb2

PDB Entry: 1ycs (more details), 2.2 Å

PDB Description: p53-53bp2 complex

SCOP Domain Sequences for d1ycsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens)}
imnkgviyalwdyepqnddelpmkegdcmtiihrededeiewwwarlndkegyvprnllg
lyp

SCOP Domain Coordinates for d1ycsb2:

Click to download the PDB-style file with coordinates for d1ycsb2.
(The format of our PDB-style files is described here.)

Timeline for d1ycsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ycsb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ycsa_