Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Bacterial alpha-Amylase [51013] (9 species) |
Species Bacillus sp. 707 [TaxId:1416] [117297] (4 PDB entries) Uniprot P19571 38-518 |
Domain d1wpca1: 1wpc A:399-485 [114799] Other proteins in same PDB: d1wpca2 complexed with ca, na |
PDB Entry: 1wpc (more details), 1.9 Å
SCOPe Domain Sequences for d1wpca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpca1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. 707 [TaxId: 1416]} gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr tgtvtinadgwgnfsvnggsvsiwvnk
Timeline for d1wpca1: