![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Bacterial alpha-Amylase [51013] (7 species) |
![]() | Species Bacillus sp. strain 707 [117297] (2 PDB entries) |
![]() | Domain d1wpca1: 1wpc A:399-485 [114799] Other proteins in same PDB: d1wpca2 complexed with aci, ca, glb, glc, gld, na |
PDB Entry: 1wpc (more details), 1.9 Å
SCOP Domain Sequences for d1wpca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wpca1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. strain 707} gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr tgtvtinadgwgnfsvnggsvsiwvnk
Timeline for d1wpca1: