Lineage for d1wpca2 (1wpc A:5-398)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571087Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 571174Protein Bacterial alpha-amylase [51447] (8 species)
  7. 571184Species Bacillus sp. strain 707 [117366] (2 PDB entries)
  8. 571185Domain d1wpca2: 1wpc A:5-398 [114800]
    Other proteins in same PDB: d1wpca1
    complexed with aci, ca, glb, glc, gld, na

Details for d1wpca2

PDB Entry: 1wpc (more details), 1.9 Å

PDB Description: crystal structure of maltohexaose-producing amylase complexed with pseudo-maltononaose

SCOP Domain Sequences for d1wpca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpca2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. strain 707}
tngtmmqyfewylpndgnhwnrlnsdasnlkskgitavwippawkgasqndvgygaydly
dlgefnqkgtvrtkygtrsqlqaavtslknngiqvygdvvmnhkggadatemvravevnp
nnrnqevtgeytieawtrfdfpgrgnthssfkwrwyhfdgvdwdqsrrlnnriykfrghg
kawdwevdtengnydylmyadidmdhpevvnelrnwgvwytntlgldgfridavkhikys
ftrdwinhvrsatgknmfavaefwkndlgaienylqktnwnhsvfdvplhynlynasksg
gnydmrnifngtvvqrhpshavtfvdnhdsqpeealesfveewfkplayaltltreqgyp
svfygdyygipthgvpamrskidpilearqkyay

SCOP Domain Coordinates for d1wpca2:

Click to download the PDB-style file with coordinates for d1wpca2.
(The format of our PDB-style files is described here.)

Timeline for d1wpca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wpca1