Lineage for d1wpca1 (1wpc A:399-485)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2419912Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 2419929Species Bacillus sp. 707 [TaxId:1416] [117297] (4 PDB entries)
    Uniprot P19571 38-518
  8. 2419931Domain d1wpca1: 1wpc A:399-485 [114799]
    Other proteins in same PDB: d1wpca2
    complexed with ca, na

Details for d1wpca1

PDB Entry: 1wpc (more details), 1.9 Å

PDB Description: crystal structure of maltohexaose-producing amylase complexed with pseudo-maltononaose
PDB Compounds: (A:) Glucan 1,4-alpha-maltohexaosidase

SCOPe Domain Sequences for d1wpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wpca1 b.71.1.1 (A:399-485) Bacterial alpha-Amylase {Bacillus sp. 707 [TaxId: 1416]}
gkqndyldhhniigwtregntahpnsglatimsdgaggskwmfvgrnkagqvwsditgnr
tgtvtinadgwgnfsvnggsvsiwvnk

SCOPe Domain Coordinates for d1wpca1:

Click to download the PDB-style file with coordinates for d1wpca1.
(The format of our PDB-style files is described here.)

Timeline for d1wpca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wpca2