Lineage for d1r26a_ (1r26 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 991975Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 992037Protein Thioredoxin [52835] (14 species)
  7. 992221Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [102430] (1 PDB entry)
  8. 992222Domain d1r26a_: 1r26 A: [96847]

Details for d1r26a_

PDB Entry: 1r26 (more details), 1.4 Å

PDB Description: Crystal structure of thioredoxin from Trypanosoma brucei brucei
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1r26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
irmrarypsvvdvysveqfrnimsediltvawftavwcgpcktierpmekiayefptvkf
akvdadnnseivskcrvlqlptfiiarsgkmlghviganpgmlrqklrdiikd

SCOPe Domain Coordinates for d1r26a_:

Click to download the PDB-style file with coordinates for d1r26a_.
(The format of our PDB-style files is described here.)

Timeline for d1r26a_: